cover
Contact Name
-
Contact Email
-
Phone
-
Journal Mail Official
-
Editorial Address
-
Location
Kota pekanbaru,
Riau
INDONESIA
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan
Published by Universitas Riau
ISSN : -     EISSN : -     DOI : -
Core Subject : Science,
Arjuna Subject : -
Articles 134 Documents
Search results for , issue " Vol 5, No 1 (2018): Wisuda April Tahun 2018" : 134 Documents clear
PERTUMBUHAN DAN KELULUSHIDUPAN IKAN PATIN SIAM (Pangasius hypopthalamus) PADA SISTEM AKUAPONIK DENGAN KEPADATAN KANGKUNG YANG BERBEDA Padli, Khairul; Rusliadi, Rusliadi; Mulyadi, Mulyadi
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

                                             ABSTRAKPenelitian ini dilakukan pada tanggal 11 Mei - 24 Juni 2017 di Laboratorium Unit Pelaksanaan Teknis (UPT) Pembenihan, Fakultas Perikanan dan Kelautan Universitas Riau. Tujuan penelitian ini untuk mengetahui pengaruh kepadatan tanaman kangkung terhadap pertumbuhan dan kelulushidupan ikan patin siam (Pangasius hypopthalamus) pada sistem akuaponik. Penelitian ini menggunakan ikan patin siam ukuran 5 -7 cm dan tanaman kangkung berumur 7 - 10 hari. Wadah yang digunakan bak terpal berukuran (50 x 50 x 50 ) cm3 sebanyak 15 unit. Sedangkan bak filter yang digunakan adalah talang air ukuran (100 x 13,5 x 10,5 ) cm3 dengan volume 14,2 L sebanyak 3 buah/unit percobaan. Metode yang digunakan adalah metode eksperimen, yakni rancangan acak lengkap 1 faktor dengan 5 perlakuan dan 3 kali ulangan. Dari hasil penelitian terbaik menunjukkan perlakuan P5 (kepadatan kangkung 50 batang/wadah) yang dapat menghasilkan bobot mutlak sebesar 9,30 gram, panjang mutlak 10,18 cm, kelulushidupan 98,90% tetapi tidak berpengaruh nyata terhadap laju pertumbuhan harian 4,74%. Kualitas air selama penelitian diperoleh ammonia (NH3) 0,01 - 0,071 mg/l, nitrit (NO2) 0,03 - 0,94 mg/l, nitrat (NO3) 0,42 - 1,46 mg/l, pH 6 - 7, DO 3,11 - 5,66 mg/l, karbondioksida (CO2) 6,92 - 11,20 mg/l, suhu 27 - 29 oC. Adapun pertambahan bobot tumbuhan filter (kangkung) (12,15 g), pertambahan panjang rata-rata tumbuhan kangkung (13,67 cm). Kata Kunci : Akuaponik, Patin Siam, Kepadatan Kangkung, Pertumbuhan dan Kelulushidupan.
THE EFFECT OF HERBAL SUPPLEMENTS ADDITION IN FEED TOWARDS GROWTH PERFORMANCE AND SURVIVAL RATE OF RED TILAPIA (Oreochromis niloticus) USING BIOFLOCS SYSTEM ON PEAT SWAMP WATER Ismayanti, Indah; Rusliadi, Rusliadi; Putra, Iskandar
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRACT This research aim to determine the optimal dose of additional herbal supplements in feed toward the growth performance and survival rate of red tilapia (Oreochromis niloticus) by using biofloc system on peat swamp water. This research was conducted on January 30-March 10, 2018 at Technical Service Unit (UPT) of Hatchery, Marine and Fisheries Faculty, University of Riau. This research was using experimental method by completely random design (RAL) one factor with three replications. The treatments were: A: 0 mL/kg of feed (control), B: 25 mL/kg of feed, C: 50 mL/kg of feed, and D: 75 mL/kg of feed. The herbal supplements were consisted of turmeric, kencur, temulawak and ginger with Bacillus sp. and yeast (Rhizopus oligosporus). The results showed that a different doses of additional herbal supplements affecting the growth performance and the survival rate of red tilapia usingbiofloc system on peat swamp water. In addition, it also affected the absolute weight growth, absolute length growth, feed efficiency and feed conversion ratio.The optimal dose was at 25 mL/kg of feed as it showed significantly different results compared to control and was not differ significantly at higher doses. So that while being applied in terms of economy, 25 mL/kg  was the most efficient dose, by giving the specific growth rate was 2,33%, survival rate was 80%, absolute weight growth was 3,12 g, absolute length was 2,71 cm, feed efficiency was 89,66% and feed conversion ratio was 1,12.                                                                                      Keyword : herbal supplements, red tilapia, biofloc, peat 
ANALYSIS OF MUDSKIPPER (Periophthalmodonschlosseri) CHEMICAL CONTENT IN DIFFERENT STEAMING TEMPERATURES Girsang, Esfi; Edison, Edison; Karnila, Rahman
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

 ABSTRACT The objective of the study was to examine the effect of varied steaming temperatures on the chemical composition of the fish flour (Periophthalmodonschlosseri). The method used was experimental and composed as Completely Randomized Design (CRD) by conducting the treatment of steaming the fish at different temperatures (60, 70, and 80 oC). The parameters assessed were the rendemen and the psycho-chemical characteristic of the fish flour. The results showed that nutrient proximate composition in fresh fish meat the dry based content of water 79.13% protein 92.83%, ash 4.54%, fat 1.13%, and carbohydrates1.50%. Steaming temperature 60oC was showing the best treatment, indicatedby yielded rendement 17.34%, the content of water 9.97%, protein 82.93%, fat 1.34% and ash 318%. The treatment of different steaming temperatures conducted was not affecting significantly to the physical appearance of fish flour, indicated by the similar aroma and texture characterized as brownish yellow color. The higher the temperature used, the darker the flour yielded color. Keywords: Mudskipper, flour, temperature, steaming
THE PROSPECT OF BUSINESS DEVELOPMENT ON EEL FISH(Anguilla sp) CULTIVATIONIN BALAI LAYANAN USAHA PERIKANAN PRODUKSI BUDIDAYA (BLUPPB) KARAWANG WEST JAVA PROVINCE Maharie, Trio Nugraha; Zulkarnaini, Zulkarnaini; Warningsih, Trisla
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRACK The research was counducted in May 2017 at the in Balai layanan Usaha Produksi Perikanan Budidaya of Karawang West Java Province. This study aims to determine the amount of total investment cost of production, net income, marketing flow, business feasibility analysis, and business development prospects of the business of raising fish in ell Fertilizer Production Business Processing Aquaculture Karawang West Java Province. The method used in this research is survey method.Cultivition of Fresh Fish Cultivation in Balai layanan Usaha Produksi Perikanan Budidaya ofKarawang West Java Province has InvestmentRp. 247.465.000, consisting of fixed capital ofRp. 74.545.000, and working capital of Rp. 172.920.000. Marketing of eel fish atBalai layanan Usaha Produksi Perikanan Budidaya of Karawang West Java Province of crop sold to collector, collector to local consumer, Business Servise Center of Production Fishery of Karawang Cultivatisibility directly to local consumer, and collector directly to overseas consumer. The results of feasibility analysis obtained a profit of  Rp. 339.915.000 per cycle (year) and RCR 2,89, FFR 137,35%, dan PPC 0,72years. The prospect of the development of eel farming business in the field of business of fishery aquaculture production business is good enough, based on the criteria of investment, marketing, and fulfillment of all sub-systems of agribusiness (subsystem input supplay, subsystem farming, and subsystem marketing).Keywords: Prospects, Business cultivation of enlargement eel fish, DistrictKarawang
THE CHANGES OF FISH FARMER’S LIVELIHOOD IN SILALAHI III VILLAGE SILAHISABUNGAN SUBDISTRICT DAIRI REGENCY NORTH SUMATERA PROVINCE Rajagukguk, Jenita; Nugroho, Firman; Kusai, Kusai
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRACTCommunity of Silalahi III Village mostly looked at fish farmers using floating net cages in Lake Toba waters, based on Presidential Decree No. 81 of 2014 in terms of cultivation area control, conducted fish folk. This research discusses the characteristics of fish farmers and the change of livelihood of fish farmers in Silalahi III Village, Silahisabungan Sub-district, Dairi Regency. The research method used survey method with data retrieval technique that is in-depth interview, field documentation and questionnaire analyzed descriptively qualitative.             The results showed the characteristics of fish farmers in the village of Silalahi III age group is very productive 15-45 years old; high school / senior high school; the number of family dependents is less than 4 people; and cultivation experience less than 3 years. The application of Pepres 81/2014 resulted in a change in the livelihood of fish cultivators, namely income decreased 14.81%; 37% employment diversification and total employment decreased by 3.70%; food consumption decreased 22.23%; social condition is cooperation relationship not continue and respondent have other job opportunity; human resources do not follow training continuously; sanitation cleanliness (clean water source 7.4% switched to lake water, all respondents had their own toilet and 51.85% and 48.14% semipermanent house housing with cement and board floor). Based on these changes, fish farmers in Silalahi III Village can still meet their daily needs. Key words : Characteristics, Livelihood Changes, Fish Farmer, Initial and Final Condition
Community Structure epi-macrozoobentos in water of Pandan Island Aquatic Tourism Area Pieh Island West Sumatera Sihaloho, Indra Y P; Samiaji, Joko; Nasution, Syafruddin
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRACT Epi-macrozoobentos are animals that live on the surface of a water base substrate and are larger than 1 mm in size. This study aims to determine the structure of epi-macrozoobenthic community which includes: species composition, abundance, diversity, uniformity, dominance and the relationship between the total organic content of sediment to epi-macrozoobenthic abundance. Environmental parameters measured include physics-chemical parameters of waters (temperature, velocity, salinity, pH and DO) as life-supporting factors of epi-macrozoobentos. The species of epi-macrozoobentos in the waters of Pandan Island were found to be 17 species from 14 families, 7 classes and 14 genera with species composition ie 74% Gastropoda class, Echinoidea 9.6%, Malacostraca 8.6%, Bivalva 3%, Asteroidea 2.6 % and Holothuridea 2.2%. Epi-macrozoobenthic abundance in Pandan Island waters ranged from 4.5 to 6.6 ind / m2 with an average of 5.3 ind / m2. The diversity index values ranged from 2.45 to 2.86, the dominance index ranged from 1.14 to 1.21 and the uniformity index ranged from 0.62 to 0.81. The total organic content of sediments ranged from 1.70 to 2.57%. Based on the diversity index (H ) of Pandan Island waters classified as moderate and medium diversity. In general, the state of the chemical physics of Pandan Island waters can still support the life of epi-macrozoobenthic organisms.Keywords: Community structure, epi-macrozoobentos, Organic matter, Pandan Island.
STUDY ON CONSUMER ACCEPTANCE OF CATFISH (Pangasius hypophthalmus) BALL WITH THE ADDITION OF YELLOW BUR HEAD (Limnocharis flava) POWDER Syahputri, Erlina Windi; Sukmiwati, Mery; N. Ira Sari, N. Ira Sari
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRACTThis research was intended to find out the consumer acceptance of catfish (Pangasius hypophthalmus) ball with addition yellow bur head (Limnocharis flava) powder. The method in this research was an experimental method on processing ofcatfish ball with addition of yellow bur head powder.The method used was experimental method with Completely Randomized Design (CRD) consisting of 4 treatment levels ie B0(without addition of yellow bur head powder), B1(addition 3% yellow bur head powder), B2(addition 6%yellow bur head powder) and B3(addition 9% yellow bur head powder). Based on the result of this research, it was determined that B1was the best treatment which organoleptic value of appearance 7.15 (95% with 76 panelists) which criteria was greenish, aroma 7.32 (91.25% with 73 panelists) which criteria was typical aroma of catfish ball and seasoning aroma was strong, taste 7.19 (91.25% with 73 panelists) which criteria was unique taste of catfish with addition of yellow bur head powder, and texture 7.46 (91.25% with 73 panelists) which criteria was smooth and soft fibers; with chemical values of moisture, ash, fiber, protein content, and total colonial bacteriawere 56.55%, 2.02%, 3.33%,16,50% and 9.4 x 104sel/gram, respectively. Keywords: Pangasius hypophthalmus, Limnocharis flava, Catfish ball
Business Analysis of Shrimp Trap Fishing Equipment (Trammel Net) In Nagari Sasak District Sasak Ranah Pasisie, West Pasaman District West Sumatera Province Zandi, Deriza Anggrioni; Hendrik, Hendrik; Arief, Hazmi
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRACT This research was conducted in March-April 2017 in Sasak Nagari District Sasak Ranah Pasisie West Pasaman District West Sumatera Province. This study aims to determine the gross revenues and net income of Fishing Jar. And to know the feasibility of Shrimp nets. The method used in this study is a survey method with the number of respondents as many as 30 people, where the determination of respondents conducted by census using the questionnaire that has been provided.The results of this study indicate a profitable fishing business based on Gross Income (GI) from fishing gear business Shrimp per year as much as  / 160 IDR. 64.613.000, - and net net income of Shrimp nets is IDR. 46.225.502, -per year. Based on financial analysis based on RCR calculation result of Shrimp fishing effort is 3.5 which means bigger 1 RCR> 1, then this business can be continued because it produces profit although not big. FRR with the calculation of net income per year / total invetasi times period, then obtained FRR yield 36.5% bigger than interest rate and get profit to invested. PPC for 43 trips which means the greater the value of PPC the longer the payback period of business investment or the smaller the value of PPC the faster the payback period of business investment Keywords : Business Analysis, Shrimp Nets, Feasibility Study, Sasak Ranah Pasisie.
EKSTRAKSI SENYAWA FENOLIK DAN KANDUNGAN KIMIA PADA RUMPUT LAUT COKLAT (Sargassumsp). Siregar, Ika Darmila; Karnila, Rahman; Sukmiwati, Mery
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRAKPenelitianinibertujuanuntukmengetahuikandungankimiadanmendeteksisenyawafenolikpositifpadaekstrakkasarSargassum sp. Metode yang digunakanadalahmetodeeksperimen dengan rancangan acak lengkap (RAL) dengan 3 taraf perlakuan yaitu P1 (rasio pelarut1:3), P2 (rasio pelarut1:6) dan P3 (rasio pelarut1:9). Parameter yang diukuradalahmeliputianalisisproksimat(kadar air, kadarabu, kadar protein, kadarlemak, dankarbohidrat), rendemendananalisisfitokimia. Rangkaianpenelitianiniterdiridari 3 tahap, yaitu 1) preparasibahanbaku. 2) analisisproksimatSargassumsp.3) analisisfitokimia. HasilpenelitianmenunjukkanbahwakomposisikimiaSargassum sp. adalahkadar air 28,20 %bk, kadarabu 33,74 %bk, kadarlemak 4,54 %bk, kadar protein 8,42 %bk, karbohidrat 53,28 %bk. Rendemen P1 1,44%, P2 3,40%, P3 6,34 %. AnalisisfitokimiapadaekstrakkasarSargassum sp.positifterdeteksisenyawafenolik.Kata kunci : Ekstraksi, Fenolik, Sargassum sp. 
THE EFFECT OF OVAPRIM DOSES ON OVULATION AND EGG QUALITY OF SILIMANG BATANG (Epalzeorhynchos kalopterus) taruli, sihombing; Sukendi, Sukendi; Nuraini, Nuraini
Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan Vol 5, No 1 (2018): Wisuda April Tahun 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Perikanan dan Ilmu Kelautan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstract The research was conducted in July 2017 in the Fish Hatchery and Breeding Laboratory of the Fisheries and Marine Sciences Faculty University of Riau. The research was to determine the effect of ovaprim on ovulation and egg quality of silimang batang (Epalzeorhynchos kalopterus). The method used is an experimental method with a completely randomized design (CRD) with four treatments and three replications. Treatment in this study were P0 (NaCl 0,9% dose of 1 ml / kg body weight) P1 (ovaprim dose of 0,3 ml / kg body weight) P2 (ovaprim dose of 0,5 ml/ kg body weight) and P3 (dose ovaprim 0,7 ml / kg body weight).The results of the research showed that the ovaprim doses 0.7 ml / kg body weight gave the optimum result inter of latent period (4,31 hours), number of egg striping (307 eggs / gram broodstock),the ovisomatik index (11,09%), increase the diameter eggs (0,145 mm) and percent increase egg maturation (21%). Keywords: Ovaprim doses, Ovulation, Ovisomatik indeks and egg quality 

Page 1 of 14 | Total Record : 134