cover
Contact Name
-
Contact Email
-
Phone
-
Journal Mail Official
-
Editorial Address
-
Location
Kota semarang,
Jawa tengah
INDONESIA
Kreano
ISSN : -     EISSN : -     DOI : -
Core Subject : Education,
Kreano, Jurnal Matematika Kreatif Inovatif adalah jurnal yang diterbitkan oleh Jurusan Matematika Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Negeri Semarang. Kreano, mempublikasikan artikel-artikel yang berisi ide, gagasan, hasil penelitian, kajian pustaka, dan kreasi inovasi lain di bidang pendidikan matematika dan pembelajarannya. Jurnal Kreano ini ber-ISSN yang diterbitkan LIPI, ISSN: 2086-2334.
Arjuna Subject : -
Articles 365 Documents
EstimasiParameter ModelMixture Of Mixture Untuk Pengeluaran Rumah Tangga Pada Data Susenas Kota Semarang Abidin, Zaenal
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 2, No 1 (2011): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v2i1.1245

Abstract

BadanPusatStatistik (BPS) memilikitanggungjawabuntukmenyediakan data yangdibutuhkandalamperencanaanpembangunan.Beberapa data sosial yang yangdihasilkanBPS diperolehmelaluiSurveiSosialEkonomiNasional(Susenas).Susenasdidesainuntukmendapatkan data sosialpendudukdalamlingkup yangluas.Tujuandaripenelitianiniadalahuntukmemperolehsuatufungsidistribusimixture ofmixture yang dibentukdarifungsidensitasrumahtanggadalambentukmixture.Dalampenelitianini, data yang akandigunakanadalah data persentasepengeluaranrata-rata per kapitasebulanmenurutjenispengeluarandangolonganpengeluaran perkapitasebulandari data SusenasKorJuli 2007 kota Semarang,untukdaerahperkotaansaja. Sebelumdilakukananalisis, dilakukaneksplorasi datadenganmengelompokan data kedalamtiapjenispengeluaran rumah tangga.Tahapberikutnya adalah menentukandistribusi data darijenispengeluaranrumahtangga.Kemudian menentukannilai parameter distribusi prior setiapjenis pengeluaran rumahtangga. Distribusi prior yang digunakanadalah prior konjugate (sekawan). Selanjutnyamenentukanmasing-masingfungsi posterior untukmasing-masingfungsisebaranpadafungsimixturewilayahdengan Bayesian –MCMCdenganmenggunakanpaket program WinBugs 1.4. Terakhir dilakukanestimasifungsisebaranmixtureofmixtureuntuktiapjenispengeluaran rumahtanggaDalampenelitianini model mixture of mixture yangdihasilkanadalah:(|, ) = 0.5011(|) + 0.4989(|). Kata kunci: MCMC, Mixture of Mixture, Susenas.
Penerapan Teknik Penilaian Learning Journal Pada Model Pembelajaran Berbasis Masalah untuk Meningkatkan Hasil Belajar Siswa Materi Pokok Segiempat -, Kartono; Imron, Ali
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 2, No 1 (2011): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v2i1.1246

Abstract

Berawal dari rendahnya prosentase jumlah siswa untuk mencapai tuntasbelajar pada pembelajaran matematika khususnya geometri. Terdapat satukegiatan yang merupakan komponen kegiatan pembelajaran yang berfungsiganda yaitu penyusunan learning journal oleh siswa. Di satu pihak berfungsisebagai sarana untuk mencapai tujuan pembelajaran dan di lain pihak sebagaiinstrumen penilaian untuk mencapai tujuan tersebut. Penelitian ini bertujuanuntuk mengetahui efektifitas penerapan teknik penilaian learing jurnal padamodel pembelajaran berbasis masalah untuk meningkatkan hasil belajar siswakelas VII pada materi pokok segiempat.Subjek dalam penelitian ini adalah siswa kelas VIIC SMPN 3Karanglewas.Metode pengumpulan data yang digunakan adalah metode tes danmetode observasi yang kemudian dilakukan analisis untuk merumuskan hasilpenelitian.Presentase ketuntasan hasil belajar siswa untuk aspek pemecahanmasalah pada siklus I = 78.79% dan siklus II = 90.91%. Presentase ketuntasanhasil belajar untuk aspek keaktifan siswa pada siklus I = 78,79 % dan siklus II =87,88 %. Dapat disimpulkan bahwa penerapan teknik penilaian learningjournalpada model pembelajaran berbasis masalah untuk meningkatkan hasilbelajar siswa kelas VII C SMPN 3 Karanglewas pada materi segiempat efektif. Kata kunci: pembelajaran berbasis masalah, learning journal.
Penerapan Model Pembelajaran Berlandaskan Pengembangan Kepribadian pada Program Studi Pendidikan Matematika Agoestanto, Arief
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1490

Abstract

This classroom action research applied personality based learning which increase students condition as subject of progressing their personality. The aims of the research were involving personality based learning model for students as mathematics teacher candidate, increasing students affection, study result based personality, dynamics of students activities and students learning process were followed multi directions interactions among students. The main finding of this study, the average of first cycle test was 50,2 and the post-test was 57, difference between them was 6,8. The average of activities and competence performance during first cycle was 6,8 this value was more than success standard i.e. 6,5. The habits of study based personality was not enough planted in themselves, but this was decreased in next cycles. The average of teaching lecturers performance during first cycle was good enough i.e. 7,1 so that was more thansuccess indicator i.e. 6,5. The average of second cycle was good enough i.e. 72,94 and the difference between them was 5,02 it was more than 5 so standard of success was attained. The average of individual score in team work was 66,67 it was more than minimum success indicator i.e. 6,5. The average of teaching lecturers performance in second cycle was 8,07 more than first one i.e. 7,33 maybe caused the lecturer was more familiar with this method.Keywords: personality based learning, mathematics teacher candidate
IDEAL Problem Solving dalam Pembelajaran Matematika Susiana, Eny
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1491

Abstract

Most educators agree that problem solving is among the most meaningful and importantkinds of learning and thingking. That is, the central focus of learning and instructionshould be learning to solve problems. There are several warrants supporting that claims.They are authenticity, relevance, problem solving engages deeper learning angtherefore enhances meaning making, and constructed to represent problems (problemsolving) is more meaningful. It is the reason why we must provide teaching and learningto make student’s problem solving skill in progress. There are many informationprocessingmodels of problem solving, such as simplified model of the problem-solvingprocess by Gicks, Polya’s problem solving process etc. One of them is IDEAL problemsolving. Each letter of IDEAL is stand for an aspect of thinking that is important forproblem solving. IDEAL is identify problem, Define Goal, Explore possible strategies,Anticipate outcme and Act, and Look back and learn. Using peer interaction andquestion prompt in small group in IDEAL problem solving teaching and Learning canimprove problem solving skill.Kata kunci: IDEAL Problem Solving, Interaksi Sebaya, Pertanyaan Penuntun, KelompokKecil.
Sifat Baik Solusi Kuadrat Terkecil Regresi Fuzzy Dengan Variabel Dependen Fuzzy Tak Simetris Kharisudin, Iqbal
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1492

Abstract

Penelitian tentang hubungan di antara fenomena-fenomena real merupakan dasardari tujuan sains dan memainkan peranan penting dalam pengambilan keputusan di dalamkehidupan sehari-hari. Analisis regresi statistik merupakan salah satu alat yang powerfuluntuk menjelaskan hubungan tersebut. Dalam makalah ini dibahas model analisis regresifuzzy dengan variabel dependen fuzzy tak simetris dan variabel independen tegas. Modeltersebut merupakan generalisasi model regresi fuzzy simetris, yaitu model regresi denganvariabel dependen fuzzy simetris. Solusi model tersebut juga merupakan generalisasi darimodel regresi linear biasa. Ide dasar analisis regresi fuzzy tak simetris adalah memodelkanpusat dari variabel dependen fuzzy tipe dengan mengadopsi model regresi klasik,selanjutnya secara simultan memodelkan tepi kiri dan tepi kanan variabel dependen fuzzymelalui model regresi linear sederhana. Pada makalah ini secara spesifik dikaji sifat-sifat baiksolusi kuadrat terkecil model regresi fuzzy dengan variabel dependen fuzzy tak simetris.Kata kunci: data fuzzy , model pusat, model tepi, solusi kuadrat terkecil.
Model Deterministik untuk Epidemi Flu Babi Pada Populasi Babi Kharis, Muhammad
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1493

Abstract

Flu babi yang pada tahun 2009 merebak membuat dunia khawatir akan terjadi epidemi yangmewabah secara global. Influensa babi merupakan penyakit saluran pernafasan akut yang sangatmenular, disebabkan oleh virus influensa tipe A yang termasuk dalam orthomyxovirus. Babimerupakan induk semang utama virus influensa babi. Virus tersebut dapat menular pada manusiadan bangsa burung atau sebaliknya. Dalam tulisan ini akan dikaji model matematika untuk epidemiflu babi pada populasi babi. Model tersebut merupakan model deterministik yang merupakanpendekatan untuk kasus epidemi ini. Diharapkan hasil kajian ini dapat bermanfaat dalampenanggulangan wabah flu babi pada sumber utama yaitu populasi babi sehingga dapat dilakukanpencegahan sebelum mewabah di populasi manusia.Kata kunci: Epidemi, Influensa babi, Model deterministik.
Proses Berpikir Induktif dan Deduktif dalam Mempelajari Matematika Rochmad, -
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1494

Abstract

Salah satu ciri utama dalam mempelajari matematika adalah menerapkan penalaran deduktif yaitukebenaran suatu konsep atau pernyataan diperoleh sebagai akibat logis dari kebenaransebelumnya, sehingga kaitan antar konsep atau pernyataan matematika bersifat konsisten. Namundemikian, pembelajaran matematika dengan fokus pada pemahaman konsep dapat diawali denganpendekatan induktif melalui pengalaman khusus yang dialami siswa. Dalam pembelajaranmatematika, pola pikir induktif dapat digunakan untuk memahami definisi, pengertian, dan aturanmatematika. Kegiatan pembelajaran dapat dimulai dengan menyajikan beberapa contoh atau faktayang teramati, membuat daftar sifat-sifat yang muncul, memperkirakan hasil yang mungkin, dankemudian siswa dengan menggunakan pola pikir induktif diarahkan menyusun suatu generalisasi.Selanjutnya, jika memungkinkan siswa diminta membuktikan generalisasi yang diperoleh tersebutsecara deduktif.Kata kunci: Pembelajaran matematika, pola pikir induktif, pola pikir deduktif.
Pengajaran Konsep Pecahan dan Kabataku Pecahan di Sekolah Dasar Mariani, Scolastika
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1495

Abstract

Tulisan ini membahas tentang pengajaran konsep pecahan dan kabataku (kali, bagi, tambah,kurang) pecahan di sekolah dasar dengan menggunakan model fisik. Model fisik ini akanmembantu siswa mengkonstruksi skema mental mereka tentang pecahan. Mengajarkan pecahantidak hanya menyangkut mentransfer ide-ide matematika, metode dan konsep, tetapi itu lebihmerupakan cara untuk mendefinisikan pecahan sebagai proses asal-usul, terjadinya danpengembangan (bertahap). Dimulai dengan menghubungkan suatu topik matematika dengankehidupan nyata, atau apa yang sekarang kita dapat menempatkan dalam paradigma genesiskontekstual. Siswa membangun konsep-konsep matematika mereka sendiri melalui pengajarankonsep pecahan dengan memperhatikan : tahap-tahap genesis kontekstual, kompleksitaskonseptual yang terkait dengan masalah pemodelan, pembelajaran pecahan yang realistik,kontekstual, menyenangkan dengan model fisik ataupun visualisasi.Kata Kunci : pengajaran konsep pecahan, kabataku pecahan, model fisik
Peningkatan Kualitas Perkuliahan Di Jurusan Matematika Fmipa Unnes Melalui Lesson Study Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1496

Abstract

Peningkatan kualitas perkuliahan di Jurusan Matematika FMIPA Unnes terus dilakukan. Salah satuupayanya adalah membangun forum sharing pengalaman di antara dosen dan mahasiswa melaluikegiatan Lesson Study. Penerapan Lesson Study antara lain berdampak pada: (1) teridentifikasinyapermasalahan belajar mahasiswa, (2) peningkatan kerja sama antar dosen dalam jurusan maupun diluar jurusan/fakultas, (3) terbentuknya kerja sama dosen dan guru di sekolah mitra, (4) peningkatanpelayanan perkuliahan, (5) diperolehnya pernagkat-perangkat perkulihan berbasis Lesson Study, (6)diperolehnya hasil-hasil penelitian dan karya ilmiah berbasis Lesson Study, dan (7) terdokumennyahasil-hasil dan pelaksanaan Lesson Study.Kata Kunci: Lesson Study, pembelajaran, permasalahan belajar
Analisis Deskriptif Soal Geometri dalam Buku Matematika Bilingual untuk Sekolah Menengah Pertama Kelas VIII Berdasarkan Kriteria International Assessment TIMSS 2007 Rahayu, Etik; Suyitno, Hardi; Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 3, No 1 (2012): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v3i1.2608

Abstract

Tujuan penelitian ini adalah untuk mendeskripsikan  domain kognitif dan aspek kognitif (required behavior) soal matematika dalam Buku Matematika Bilingual untuk Sekolah Menengah Pertama (SMP) Kelas VIII berdasarkan kriteria International Assessment TIMSS 2007 dan proporsinya. Metode penelitian yang digunakan adalah deskriptif kualitatif, dengan subjek penelitian adalah soal geometri dalam Buku Matematika Bilingual SMP. yang berjudul “Mathematics for Junior High School Grade VIII 1st Semester” dan “Mathematics for Junior High School Grade VIII 2nd Semester” karangan karangan M. Cholik Adinawan dan Sugijono. Pengumpulan data menggunakan metode observasi dan wawancara tentang penggunaan buku matematika bilingual yang paling banyak digunakan di kota semarang. Pedoman analisis soal berdasarkan kriteria International Assessment TIMSS 2007, dengan validasi hasil oleh ahli. Hasil penelitian menunjukkan bahwa soal yang dianalisis memuat satu hingga tujuh aspek kognitif. Sebagian besar soal memuat 4 aspek kognitif yaitu 44.04 %, diikuti soal dengan 3 aspek kognitif  yaitu 36, 42%,  soal dengan 2 aspek kognitif yaitu 14, 90%, kemudian 1,99% untuk soal dengan 1 atau 5 aspek kognitif, dan 0,33% untuk soal dengan 6 atau 7 aspek kognitif. Proporsi tinggi pada recall (28.26%) dan compute (26.57%), diikuti dengan SRP (10.85%), implement (10.65%), retrieve (8.36%), recognize (6.17%), analyze (1.99%), measure (1.59%), generalize (1.09%), SNRP (1.00%), classify (0.80%), represent (0.80%), justify (0.80%), select (0.60%), model (0.30%), synthesis (0.20%). Secara keseluruhan berdasarkan International Assessment TIMSS 2007 soal yang termasuk domain knowing memiliki persentase paling tinggi (52.28%), domain knowing-applying (24.83%), domain knowing- reasoning (12.91%), dan hanya sedikit yang termasuk domain knowing-apllying-reasoning (3.97%). Serta terdapat 4 soal (1.32%) yang mempunyai ketidaksesuaian penggunaan mathematics terms serta 1 soal (0.33%) mempunyai kesalahan penyajian dalam  soal versi bahasa Inggris. Hasil penelitian menunjukan bahwa aspek kognitif (required behavior) yang termasuk dalam domain reasoning sangat sedikit dibandingkan dengan aspek kognitif (required behavior) pada domain knowing dan applying yakni 5.07%.

Page 2 of 37 | Total Record : 365