Articles

Found 8 Documents
Search

TANAMAN PAKAN TERNAK SEBAGAI PENGUAT TERAS Herawati, Tati; Miranti, Miranti
Pastura : Jurnal Ilmu Tumbuhan Pakan Ternak Vol 1 No 2
Publisher : Udayana University

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (71.575 KB) | DOI: 10.24843/Pastura.2012.v01.i02.p01

Abstract

Research activities have been carried out to study the role of fodder plant terrace in the Canggal village, kecamatan Kledung, kabupaten Temanggung. It is located on a plateau with slope range between 15-45%. Treatment aims were to conserve the slopes land with grass fodder crops by planting terrace with grass. The measurement was done on the soil erosion which belongs to the rorak made on each end of the strip. The results showed that planting in slopes areas with grass strips reduced erosion rate by 26%. With the planting strip of grass, still showed the existence of differences in erosion in different precipitation levels. But with a strip of grass, the rate of erosion on the slope of 30-45% can be pressed to no different than land that has a slope of 15-25%. Technology of strengthening terrace as part of the conservation of wetlands has been adopted by cooperator farmers and growing to non cooperators.
TEACHING LISTENING COMBINING SLANT AND TQLR STRATEGIES TO IMPROVE STUDENTS LISTENING ABILITY AT SENIOR HIGH SCHOOL Miranti, Miranti; Agusni, Agusni
Pendidikan Bahasa Inggris Vol 2, No 2 (2013): Jurnal Mahasiswa Bahasa Inggris Genap 2012-2013
Publisher : Pendidikan Bahasa Inggris

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRAKMakalah ini ditulis bertujuan untuk membantu mengatasi salah satu dari permasalahan yang ada dalam pengajaran mendengar (listening) pada Sekolah Menengah Atas  (SMA). Selain itu makalah ini juga dimaksudkan sebagai masukan bagi guru-guru bahasa Inggris dalam melaksanakan pembelajaran listening sehingga siswa tertarik dan termotivasi untuk belajar listening khususnya procedure text.            Dalam makalah ini, penulis membahas bagaimana pengajaran listening melalui penggunaan kombinasi SLANT strategy  dan TQLR strategy. Strategi kombinasi ini memepermudah guru meningkatkan keinginan siswa dalam mendengar dan memahami pesan yang disampaikan oleh pembicara.SLANT strategy membantu siswa untuk lebih siap sebelum mendengarkan teks dan membantu memahami teks melalui mencatat ide-ide pokok yang di sampaikan oleh pembicara. Prosedur SLANT yaitu Sit Up:siswadudukdenganposisi yang tepat, Lean Forward:siswamenyiapkandiriuntukbelajar, Activate Thinking :siswamengaktifkanpikiranmengaitkanpengetahuandenganmateri yang akan di pelajari, Note Key Idea : siswamencatat ide pokokdan Track the Speaker :siswamelakukantanyajawabdengan guru tentangmateri yang telahdipelajari. TQLR strategy membantu siswa untuk mangaktifkan pikiran dan membuat pertanyaan tentang  topik yang akan di dengar. Hal ini dapat membantu siswa lebih mudah untuk menangkap pesan dari pembicara. Prosedur TQLR yaitu Tune in :siswamenebakmateripembelajaranmelaluigambar yang ditampilkanoleh guru, Question: siswamembuatpertanyaan yang berhubungandenganmateri yang akan di pelajari, Listen :siswamendengarkanrekamandan Review : siswadan guru melakukandiskusidanmemberipenguatanterhadapmateri yang telahdipelajari.
Faktor-faktor yang mempengaruhi tingginya Keterwakilan perempuan pada pemerintahan Desa Tambun Arang Mardiana, Mardiana; Miranti, Miranti; Maryam, Siti
Jurnal Politik dan Pemerintahan Daerah Vol 1, No 1 (2019): Juni
Publisher : Universitas Muara Bungo

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (268.223 KB) | DOI: 10.36355/jppd.v1i1.3

Abstract

Perempuan memiliki peran vital di dalam kehidupan. Untuk menghadapi perkembangan jaman, di era ke-21 ini perempuan juga tak kalah dengan kaum laki-laki. Pada pemerintahan pun perempuan banyak yang menduduki jabatan. Penelitian ini bertujuan untuk menganalisis factor-faktor yang mempengaruhi tingginya keterwakilan perempuan pada pemerintahan Desa Tambun Arang. Penelitian ini merupakan penelitian deskriptif kualitatif. Hasil penelitian menunjukkan bahwa faktor-faktor yang mempengaruhi tingginya keterwakilan perempuan dalam pemerintahan Desa Tambun Arang adalah ketokohan dalam masyarakat dan kekuatan untuk menyerap aspirasi perempuan. Program yang telah dilakukan untuk perempuan di Desa Tambun Arang diantaranya yaitu Senam Tebo, Peralatan Prasmanan, Kursus menjahit dan Memasak, Pertemuan mingguan dan yasinan.
Meningkatkan Hasil Belajar siswa pada mata pelajaran PKn di Kelas III SDN Paranggi Kecamatan Ambpibabo Melalui Metode Pemberian Tugas Individu Miranti, Miranti; Imran, Imran; Firmansyah, Arif
Jurnal Kreatif Tadulako Online Vol 5, No 12 (2017): Jurnal Kreatif Tadulako Online
Publisher : Jurnal Kreatif Tadulako Online

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (14.194 KB)

Abstract

Penelitian  ini  adalah  penelitian tindakan  kelas dengan menerapkan  Model Pembelajaran pemberian tugas individual .Metode pemberian tugas adalah suatu cara mengajar yang dicirikan oleh adanya kegiatan perencanaan antara murid dengan guru mengenai suatu persoalan atau problema yang harus diselesaikan/dikuasai oleh murid dalam jangka waktu tertentu yang disepakati bersama antara murid dan guru. Masalah yang  hendak  dipecahkan  dalam  penelitian  ini  adalah  apakah  dengan  model pembelajaran pemberian tugas individu dapat  meningkatkan hasil belajar siswa di kelas III SDN Paranggi.  Penelitian  ini  terdiri  dari dua siklus, pada setiap siklus terdiri dari  empat  tahap  yaitu : perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian  ini  melibatkan 18 siswa  dikelas III SDN Paranggi, yang  tediri  dari 10  siswa  laki-laki dan 8  siswa  perempuan Hasil  penelitian  menunjukkan  bahwa  terjadi  peningkatan hasil belajar siswa seiring  dengan  diterapkannya  model pembelajaran pemberian tugas individu  yakni  dapat  dilihat  dari  hasil  observasi aktivitas siswa yang  diperoleh  pada  siklus I, yakni  56,25% dan  75,00%, serta aktifitas  siswa  dalam kategori cukup. Pada  siklus  II  diperoleh 75,00% dan 87,50% dengan  peningkatan aktifitas siswa berada dalam kategori sangat baik dan hasil belajar siswa pada siklus I yang diperoleh daya serap klasikal yaitu 70,56% dan pada siklus II daya serap klasikal 80,56%  Dengan demikian, berdasarkan hasil penelitian  menunjukkan bahwa penggunaan metode pemberian tugas individu dapat meningkatkan hasil belajar siswa  di kelas III SDN  Paranggi. Kata Kunci: Peningkatan Hasil Belajar Siswa; Metode Pemberian Tugas Individu
PENGARUH KEGIATAN OUTBOUND STEPPING CARPET TERHADAP KECERDASAN INTERPERSONAL ANAK USIA 5-6 TAHUN DI TK BINA MANDIRI KECAMATAN RAMBAH HILIR KABUPATEN ROKAN HULU Miranti, Miranti; Risma, Devi; Hukmi, Hukmi
Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan Vol 5: Edisi 2 Juli-Desember 2018
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstract: This study aims to determine the effect of outbound stepping carpet on interpersonal intelligence in children aged 5-6 years in TK Bina Mandiri Rambah Hilir District Rokan Hulu District. The research used experimental method with one group pre-test post-test design. The sample used in this study were 18 students. The data collection technique used is observation. Technique of data analysis using t-test test by using program of SPSS 23. The research hypothesis is that there is influence of outbound stepping carpet toward interpersonal intelligence in children aged 5-6 years in TK Bina Mandiri Kecamatan Rambah Hilir Rokan Hulu Regency. Based on data analysis known tcalculated = 15,605> ttable = 2,110 with Sig. (2-tailed) = 0,000. Because Sig <0,05 it can be concluded that there are differences of interpersonal intelligence before and after done outbound stepping carpet. It can be interpreted that there is influence of outbound stepping carpet activity toward interpersonal intelligence in children aged 5-6 years in TK Bina Mandiri Subdistrict Rambah Hilir Rokan Hulu significant as much as 48.26%.Keyword: Interpersonal Intelligence, Outbound Stepping Carpet Activities
HUBUNGAN PENURUNAN KEKUATAN OTOT DAN MASSA OTOT DENGAN PROSES PENUAAN PADA INDIVIDU LANJUT USIA YANG SEHAT SECARA FISIK Lintin, Gabriella Bamba Ratih; Miranti, Miranti
Healthy Tadulako Vol 5, No 1 (2019)
Publisher : Healthy Tadulako

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (421.135 KB)

Abstract

Penurunan massa otot dan kekuatan otot pada individu lanjut usia menjadi masalah aditif dengan prevalensi yang tinggi. Menilai kehilangan massa otot dan kekuatan otot yang berhubungan dengan usia serta menentukan mekanisme terjadinya atrofi otot pada proses penuaan, struktur otot dan komposisi serat otot telah dilakukan, dengan menggunakan teknik invasif dan noninvasif. Penurunan ukuran volume secara bertahap seiring bertambahnya usia, disertai penggantian oleh jaringan lemak dan ikat. Penurunan massa otot dan kekuatan otot, tampaknya disebabkan oleh pengurangan jumlah dan ukuran serabut otot, terutama tipe 2, dan sampai batas tertentu disebabkan oleh proses neurogenik progresif perlahan. Memperbaiki penurunan massa dan kekuatan otot dapat dilakukan dengan meningkatkan kekuatan otot yaitu dengan olahraga
ANALISIS KUALITAS SOAL TES TERTULIS TINGKAT SMA OLIMPIADE BIOLOGI SE-RIAU DAN KEPULAUAN RIAU TAHUN 2018 BERDASARKAN RANAH KOGNITIF TAKSONOMI BLOOM Miranti, Miranti; Fauziah, Yuslim; Darmawati, Darmawati
Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan VOL 6 : EDISI 2 JULI - DESEMBER 2019
Publisher : Jurnal Online Mahasiswa (JOM) Bidang Keguruan dan Ilmu Pendidikan

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Abstact: This research was conducted to analyze item quality of written test for Senior High School in Biology Olimpiad at Riau dan Kepulauan Riau 2018. This research was carried out in October – November 2018. This research is a descriptive research, the data analyzed by quantitative method composed by difficult level, distinguishing power, fungtion of distractor, validity and reliability item and see domain cognitive by Taksonomi Bloom. Data source in this research are secondary data used participant answer sheet as the data. The result of quntitative method show that written test in the bad category based on clasification qualitative analyze, because only 15 items accepted, 76 items need to repaired and 9 items was rejected.Key Words: Analysis Item Quality, Wtitten Test, Taksonomi Bloom
PEMODELAN FAKTOR - FAKTOR PENYEBAB KEPARAHAN KORBAN KECELAKAAN LALU LINTAS DI KOTA AMBON DENGAN MENGGUNAKAN MODEL REGRESI LOGISTIK MULTINOMIAL Miranti, Miranti; Rumlawang, F. Y.; Kondolembang, F.
VARIANCE : Journal of Statistics and Its Applications Vol 1 No 1 (2019)
Publisher : Statistics Study Programme, Department of Mathematics, Faculty of Mathematics and Natural Sciences, University of Pattimura

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (639.46 KB) | DOI: 10.30598/variancevol1iss1page17-26

Abstract

Traffic accidents are one of the main causes of the highest increase in mortality in Indonesia. This problem needs attention to anticipate the fall of the death toll in a traffic accident. So in this study, there are response variables and several predictor variables. The purpose of this study was to find out what factors influence the severity of traffic accident victims in Ambon city based on categories and model the severity of traffic accident victims in Ambon city based on significant factors using the Multinomial Logistic Regression method. In this study, the results obtained are factors that significantly affect the severity of the traffic accident victims are sex variables (X1), age (X1), education (X3) and type of vehicle (X5).